Sign In | Join Free | My blogcoquefr.com
blogcoquefr.com
Products
Search by Category
Home > Chemicals > Elementary Substance >

Cjc 1295 Dosage

cjc 1295 dosage

All cjc 1295 dosage wholesalers & cjc 1295 dosage manufacturers come from members. We doesn't provide cjc 1295 dosage products or service, please contact them directly and verify their companies info carefully.

Total 4087 products from cjc 1295 dosage Manufactures & Suppliers
Wholesale  from china suppliers

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest ......

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale  from china suppliers

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-......

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale  from china suppliers

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer ......

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Wholesale  from china suppliers

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:China

...-0 Customized: Customized Suitable for: Adult Purity: >99% Cjc-1295 Without Dac Other Name: Cjc-1295 Without Dac Cjc-1295 Without Dac CAS: 87616-84-0 Cjc-1295 Without Dac MW: ......

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Wholesale  from china suppliers

Brand Name:CJC-1295 Without DAC

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their ......

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Wholesale  from china suppliers

Brand Name:ChineseHormone

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC 1295 Without DAC Growth Hormone Releasing Hormone For Weight Loss Quick View: CJC 1295 without DAC is a 30 amino acid peptide hormone, better known in the community ......

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Wholesale  from china suppliers

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What ......

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale  from china suppliers

Brand Name:Pharmagrade Steroids

Model Number:863288-34-0

Place of Origin:China

...High Purity Peptide CJC-1295 Without Dac (2mg/Vial) CAS:863288-34-0 Muscle Building Product Descripition: CAS 863288-34-0 Appearance ......

HUBEI PHARMAGRADE STEROIDS., LTD
Verified Supplier

Hubei

Wholesale  from china suppliers

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:Wuhan

...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser......

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Wholesale  from china suppliers

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

... Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or ......

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Wholesale  from china suppliers

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS ......

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale  from china suppliers

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): ......

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Wholesale  from china suppliers

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649......

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale  from china suppliers

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 ......

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Wholesale  from china suppliers

Brand Name:HBU

Model Number:51753-57-2

Place of Origin:CHINA

...99% Purity Cjc-1295 with Dac for Fat Burning 2mg / Vial Cjc-1295 with Dac Cjc-1295 with Dac CAS:51753-57-2 Other Name:Grf 1-29 Purity (HPLC):98% MF: C165H271N47O46 MW: ......

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale  from china suppliers

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:China, Hunan

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, ......

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Wholesale  from china suppliers

Brand Name:HZ

Model Number:CAS:863288-34-0

Place of Origin:China

... Growth Steroid Cjc-1295 with Dac for Muscle Enhance Quick Detail: Products Name; CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular Weight: 3649.30 ......

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Wholesale  from china suppliers

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their ......

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Wholesale  from china suppliers

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha......

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Wholesale  from china suppliers

Brand Name:CJC-1295 Acetate

Model Number:863288-34-0

Place of Origin:SHANGHAI

...CJC-1295 Acetate CAS : 863288 34 0 Human Growth Hormone HGH for Bodybuilding and Weight Loss Product Name: CJC-1295 Acetate Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr......

ShangHai ShuCan industrial co.. LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request