Sign In | Join Free | My blogcoquefr.com
blogcoquefr.com
Products
Search by Category
Home > Chemicals > Water Treatment Chemicals >

Cjc 1295 Dosage

cjc 1295 dosage

All cjc 1295 dosage wholesalers & cjc 1295 dosage manufacturers come from members. We doesn't provide cjc 1295 dosage products or service, please contact them directly and verify their companies info carefully.

Total 3122 products from cjc 1295 dosage Manufactures & Suppliers
Wholesale CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits from china suppliers

Brand Name:steroidphar

Model Number:863288-34-0

Place of Origin:China

CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest ...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale CJC 1295 Without DAC 2mg Lyophilized Peptide Hormone CJC-1295 Dosage Benefits from china suppliers

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Wholesale Peptide Hormones Bodybuilding , Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac from china suppliers

Brand Name:wumeitech

Model Number:Cjc-1295 Without Dac

Place of Origin:China

Cjc-1295 Peptide Human Growth Steroid Cjc-1295 Without Dac for Muscle Enhance Mod GRF (1-29) Cjc-1295 Without Dac CAS:863288-34-0 Cjc-1295 Without Dac Assay:>99% Cjc-1295 Without ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Wholesale CJC-1295 Without DAC 863288-34-0 Releasing Hormones (GHRH) purity 98% from china suppliers

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action ...

HONGKONG YUANCHENG GONGCHUANG TECHNOLOGY Co., LIMITED
Verified Supplier

Hong Kong

Wholesale 30 Amino Acid Strongest Peptide For Muscle Growth Cjc-1295 Without Dac Powder from china suppliers

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:China

30 Amino Acid Strongest Peptide For Muscle Growth Cjc-1295 Without Dac Powder 1, Basic Info. Model NO.: 87616-84-0 Customized: Customized Suitable for: Adult Purity: >99% Cjc-1295 ...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Wholesale CJC-1295 Without DAC Hormone Peptide 2mg/Vial Cjc-1295 with Dac for Fat Loss from china suppliers

Brand Name:Yuancheng

Model Number:/

Place of Origin:China

Product name CJC-1295 no DAC Unit Size 2mg/vial Appearance Lyophilized White Powder CAS NO. Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala...

Zhuzhou Yuancheng Hezhong Tech & Dev Co., Ltd
Verified Supplier

Hunan

Wholesale Effective CJC-1295 Acetate Human Growth Hormone Peptide Bodybuilding 99% purity 863288-34-0 from china suppliers

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:China

Effective CJC-1295 Acetate Human Growth Hormone Peptide Bodybuilding 99% purity 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Wholesale Body Building Growth Hormone Peptides CJC-1295 Acetate with 863288-34-0 from china suppliers

Brand Name:JCJ

Model Number:Cas No.: 863288-34-0

Place of Origin:China

Body Building Growth Hormone Peptides CJC-1295 Acetate with 863288-34-0 Basic Information Product Name: CJC-1295 Acetate Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys...

JCJ Logis Co.,ltd
Verified Supplier

Hubei

Wholesale CJC-1295 with DAC Safe Human Growth Hormone Peptide CAS 863288-34-0 from china suppliers

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone Quick Detail Products Name: CJC 1295 CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46 Molecular ...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Wholesale Human Growth Peptides CJC 1295DAC  CJC 1295 with DAC for fat burning CAS 863288-34-0 from china suppliers

Brand Name:Nanjian

Place of Origin:China

CJC 1295DAC Human Growth Peptides CJC 1295 with DAC for building muscle CAS 863288-34-0 Synonym CJC1295/DAC, CJC-1295 with dac, CJC 1295 CAS NO 863288-34-0 Molecular Formula ...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Wholesale Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 from china suppliers

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial CAS: 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 ...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Wholesale 99.99% White Lyophilized Powder Steroid Injections Cjc-1295 Dac Pure Peptides 2 Mg/ Vial from china suppliers

Brand Name:YUANCHENG

Model Number:HKYC

Place of Origin:CHINA

Manufacture Direct Sale Steroid Injections Cjc-1295 Dac Pure Peptides 2 Mg/ Vial Basic Info: Port: shenzhen, China Production Capacity:500-1000kg/Month Payment Terms: T/T, Western ...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Wholesale Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder from china suppliers

Brand Name:Huao(skype:mia9403)

Model Number:CJC-1295 with DAC

Place of Origin:China

Growth Hormone Releasing Hormone GHRH CJC 1295 With DAC For Bodybuilder Contact Abby by trustful@ycgmp.com Skype:mia9403 Whatsapp:+8618826123740 Quick detail : CJC 1295 With DAC ...

Guangzhou Huao Chemical Co.,Ltd
Verified Supplier

Guangdong

Wholesale Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide from china suppliers

Brand Name:KANGDISEN

Model Number:2 mg/vial

Place of Origin:China

Muscle Mass Human Growth Hormone Steroids CJC-1295 Without DAC Peptide Modified GRF (1-29), CJC-1295 no DAC Modified Growth Releasing Factor aminos 1-29, usually referred to as ...

Hongkong Kangdisen Medical Co., Limited
Verified Supplier

Hong Kong

Wholesale Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning from china suppliers

Brand Name:HongKong Blue Universal Co., Limited.

Model Number:51753-57-2

Place of Origin:China

Releasing Hormone Peptides Cjc - 1295 With Dac Polypeptides For Fat Burning 1.Quick Details: Contact info. ---skype: mabel_3566;Email : mabel@sinosteroids.com Product Name---Cjc - ...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Wholesale Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 from china suppliers

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Wholesale Hormone Peptides CJC-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 from china suppliers

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr...

Wuhan Hezhong Biochemical Manufacturing Co., Ltd.
Verified Supplier

Hubei

Wholesale 2Mg Per Vial Growth Hormone Peptides CJC 1295 White Freeze Dried Powder from china suppliers

Brand Name:Shanghai Stero

Model Number:Cjc1295

Place of Origin:China

2Mg Per Vial Growth Hormone Peptides Cjc1295 Without Dac Cjc1295 Dac CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a growth hormone ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Wholesale CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production from china suppliers

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Wholesale CAS 863288-34-0 Peptides CJC 1295 DAC CJC-1295 Dosage Bodybuilding from china suppliers

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request