Sign In | Join Free | My blogcoquefr.com
blogcoquefr.com
Products
Search by Category
Home > Chemicals > Inorganic Acid >

Cjc 1295 Dosage

cjc 1295 dosage

All cjc 1295 dosage wholesalers & cjc 1295 dosage manufacturers come from members. We doesn't provide cjc 1295 dosage products or service, please contact them directly and verify their companies info carefully.

Total 5913 products from cjc 1295 dosage Manufactures & Suppliers
Cheap CJC 1295 Without DAC Growth Hormone Peptides White Lyophilized Peptide HGH CJC-1295 Dosage Benefits wholesale

Brand Name:Yvonne

Model Number:863288-34-0

Place of Origin:China

...CJC 1295 Without DAC 2mg/vial White Lyophilized Peptide HGH CJC-1295 Dosage Benefits Attention: China 14 years old Manufacturer direct selling; Gold Member, Gold Quality; Lowest price ...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Cheap CJC 1295 Without DAC 2mg Lyophilized Peptide Hormone CJC-1295 Dosage Benefits wholesale

Brand Name:steriodshow

Model Number:CJC-1295(Without DAC) CAS 863288-34-0

Place of Origin:china manufactuer

...CJC-1295 CJC 1295(Without DAC) Alias: CJC-1295 Acetate; CJC-1295(Without DAC) ; Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-...

Zhuhaishi Shuangbojie Technology Co.,ltd
Verified Supplier

Guangdong

Cheap Weight Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 wholesale

Brand Name:Sendi

Model Number:CJC-1295 With DAC

Place of Origin:China

... Loss Peptides CJC-1295 / CJC-1295 With DAC Growth Hormone 2mg/vial 863288-34-0 2mg/vial $15/vial MOQ: 10 vials 10 vials -- $150 100 vials -- $1200 Shipping cost: $50 What is CJC-1295? 1. Cjc-1295 is also...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Cheap Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 wholesale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

...Peptide Hormones Bodybuilding CJC-1295 Without DAC / CJC-1295 CJC-1295 Details CJC-1295 CAS No. 863288-34-0 CJC-1295 Molecular Formula C152H252N44O42 CJC-1295 Molecular weight 3367.2 CJC-1295 Synonyms CJC-1295 without DAC, CJC 1295 w/o DAC, MOD GRF 1-29, ...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Cheap Injectable Peptides Supplements Bodybuilding CJC-1295 2mg / Vial For Performance Enhancement wholesale

Brand Name:LSW

Model Number:CJC-1295 2mg / Vial

Place of Origin:China

..., if you visit your favorite peptide company’s internet site, you will notice that there is a CJC-1295 with, and another one without DAC. Logically, you will ask yourself - what are the differences...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Cheap 5mg/vial Protein Peptide Hormones 100% Safe DHL to USA CJC 1295 with Dac wholesale

Brand Name:Bodybiological

Model Number:CJC 1295 with Dac

Place of Origin:Hubei, China

...-Ile-Leu-Ser-Arg-Lys(Maleimidopropionyl)-NH2 Item: CJC1295 With Dac Synonyms: Mod GRF 1-29, CJC-1295 no DAC,CJC-1295 with DAC, CJC 1295 with DAC CAS No.: 863288-34-0 Molecular Formula: C165H271N47O46

Wuhan Body Biological Co.,Ltd
Verified Supplier

Hubei

Cheap High Quality Human Peptides 51753-57-2 2mg/Vial Cjc-1295 with Dac for Weight Loss wholesale

Brand Name:HongKong Blue

Model Number:Cjc-1295 with DAC

Place of Origin:CHINA

...High Quality Peptide 51753-57-2 2mg/Vial Cjc-1295 with Dac for Weight Loss Basic Info Producing Country: China Wholesale: Yes Mgf Specification: 2mg/...

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Cheap White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0 wholesale

Brand Name:Nanjian

Place of Origin:China

...White Lyophilized Peptides 2mg CJC 1295 Without DAC CAS 863288-34-0​ Quick Detail: Product Name CJC-1295 Synonym CJC-1295 Acetate; CJC1295(Without DAC) CAS NO 863288-34-0 Molecular Formula C165H271N47O46 Molecular weight 3649.30...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Cheap Releasing Hormones Peptides Powder CJC-1295(Dac) Injectable For Bodybuilding CAS: 863288-34-0 wholesale

Brand Name:HKYC

Model Number:muscle building

Place of Origin:HUBEI,CHINA

... know I will give info.in details. kathelin@yccreate.com Skype:live:kathelin_4 WhataApp:+8618872220706 Description 1.CJC-1295 is a tetrasubstituted 30-amino acid peptide hormone, primarily functioning as a releasing hormone (GHRH) analog.One...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Cheap Bodybuilding Human Growth Hormone Peptide Cjc 1295 with Dac CAS 863288-34-0 wholesale

Brand Name:Biofriend

Model Number:863288-34-0

Place of Origin:Wuhan

...Hormone Peptides Cjc-1295 with Dac for Bodybuilder Health Supplement CAS 863288-34-0 Quick Detail : Product Name CJC-1295 Acetate Sequence Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val...

Wuhan Biofriend Technology Co.,Ltd
Verified Supplier

Hubei

Cheap Injectable Anabolic Steroids Peptide CJC-1295 DAC  With DAC Lyophilized Powder wholesale

Brand Name:Kafen

Model Number:863288-34-0

Place of Origin:China

...Sell High Quality Injectable Anabolic Steroids Peptide CJC-1295 DAC With DAC Lyophilized Powder Basic Info. other name: CJC1295dac, CJC1295withDAC Product Description: CJC-1295 2mg/Vial Type: Immune Function AgentsGrade Standard: Medicine Grad ...

Guangzhou Kafen Biotech Co.,Ltd
Verified Supplier

Guangdong

Cheap 30 Amino Acid Strongest Peptide For Muscle Growth Cjc-1295 Without Dac Powder wholesale

Brand Name:Gear Steroids

Model Number:87616-84-0

Place of Origin:China

...-0 Customized: Customized Suitable for: Adult Purity: >99% Cjc-1295 Without Dac Other Name: Cjc-1295 Without Dac Cjc-1295 Without Dac CAS: 87616-84-0 Cjc-1295 Without Dac MW: 873.01 Cjc-1295 Without Dac Appearance: White Lyophilized Powder Specification...

Shanghai Rong Can Science And Technology Co., Ltd.
Verified Supplier

Shanghai

Cheap CJC-1295 Without DAC 863288-34-0 Releasing Hormones (GHRH) purity 98% wholesale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action in the ...

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Cheap Injectable Muscle Building Peptides Bodybuilding CJC 1295 Without DAC 863288-34-0 wholesale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Injectable CJC 1295 Growth Hormone Peptide CJC 1295 Without DAC Weight Loss 1. CJC 1295 Information: Product name: CJC 1295 Appearance: White Lyophilized Powder Purity (HPLC): 99.19% Single Impurity(HPLC): 1.0% Amino Acid Composition: 10% ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Cheap Powerful CJC 1295 With Dac Growth Hormone Peptide 2mg For Lean Muscles wholesale

Brand Name:Pharmlab

Model Number:CJC 1295

Place of Origin:China

...Powerfull Growth Hormone Releasing Hormone CJC 1295 With Dac 2mg For Lean Muscles Quick detail Product Description: CJC-1295 2mg/Vial MF: C165H271N47O46 Molecular Weight: 3649.30 Purity (HPLC): 98.0% Appearance: Lyophilized powder Single...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Cheap Powdered CJC-1295 with DAC Safe Anti Aging Hormones Acetate Growth Hormone CJC-1295 wholesale

Brand Name:HKYC

Model Number:863288-34-0

Place of Origin:China

...: Unit Size :2 mg/vial Unit Quantity :1 Vial CAS NO. :863288-34-0 Synonyms :CJC1295/DAC, CJC-1295 with dac, CJC 1295 Molecular Formula :C165H269N47O46 Molecular Weight :3647.19 Sequence :H-Tyr-D-Ala-Asp-Ala-Ile-Phe...

Hongkong Yuancheng Gongchuang Technology Co., Limited
Verified Supplier

Hong Kong

Cheap CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 wholesale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

...CJC-1295 Peptides Human Growth Steroid CJC-1295 Without Dac For Muscle Enhance 863288-34-0 Product Description: Synonyms: CJC-1295 without DAC, CJC 1295 no DAC, , Neorelin, Modified Sermorelin CAS NO.: 863288-34-0 Molecular Formula: C152H252N44O42 ...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Cheap CAS 863288-34-0 Peptides CJC 1295 DAC CJC-1295 Dosage Bodybuilding wholesale

Brand Name:CJC 1295

Model Number:CAS 863288-34-0

Place of Origin:China

...Peptide CJC-1295 DAC Peptides For Bodybuilding Quick details CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Growth Hormone Releasing Hormones (GHRH). Their action ...

Shenzhen Ghormone Biotech Co.,Ltd
Active Member

Guangdong

Cheap Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass wholesale

Brand Name:Latterson

Model Number:2922199090

Place of Origin:China

...Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass Basic Info Product name CJC-1295 with DAC CAS register number 863288-34-0 Molecular formula C165H271N47O46 Molecular weight 3649.30 Assay ...

Zhongshan Latterson Biotechnology Co., Ltd.
Active Member

Cheap CJC-1295 Acetate Cas : 863288-34-0 HGH Human Growth Hormone 2mg or 5mg with Safety Shipping wholesale

Brand Name:SHUCHAN

Model Number:863288-34-0

Place of Origin:wuhan

keywords:Bivalirudin Trifluoroacetate;Cas No.: 128270-60-0 Quick Detail: Product Name: CJC1295 Synonyms: CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl...

ShangHai ShuCan Industrial Co,.LTD
Active Member

Shanghai

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request